DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and LOC562139

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001075159.1 Gene:LOC562139 / 562139 -ID:- Length:263 Species:Danio rerio


Alignment Length:267 Identity:104/267 - (38%)
Similarity:146/267 - (54%) Gaps:30/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLSVVALVALAASCHGNPGLDFP----FGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSE 65
            :||.:||:..|..| |.|.:. |    :.||||||:....::|:|||:|.:.|.||||||||:..
Zfish     6 ILSCLALIGTAYGC-GVPAIP-PVITGYARIVNGEEAVPHSWPWQVSLQDSTGFHFCGGSLINEW 68

  Fly    66 TVLTAAHCMQSYAASELQVRVGSTSRSSGGE---VVTV-RAFKYHEGYNSKLMINDVAIIKLSSP 126
            .|:|||||   ...:..:|.:|...|||..|   .:|| :.|| |..:|...:.||:.:|||::|
Zfish    69 WVVTAAHC---NVRTSHRVILGEHDRSSNAEPIQTMTVGKVFK-HPNFNMFTINNDILLIKLATP 129

  Fly   127 VRQTSKIRAIELADS--EAVSGTNAVVSGWGTTCFLFCSSPDT---LQKVEVDLLHYKDCAADTY 186
            .:..:.:..:.||::  ....|...|.||||.|..   ::|||   ||:..:.||..:||.    
Zfish   130 AKINTHVSPVCLAETNDNFPGGMKCVTSGWGLTKH---NAPDTPALLQQAALPLLTNEDCK---- 187

  Fly   187 NYGSDSILETMVCATGEKKDACQGDSGGPLVADN----KLVGVVSWGSGCAWTGYPGVYADVASL 247
            .:..:.|.:.||||......:|.||||||||...    .|||:|||||....|..|||||.|..|
Zfish   188 RFWGNKITDLMVCAGASGASSCMGDSGGPLVCQKDGVWTLVGIVSWGSSVCSTSSPGVYARVTKL 252

  Fly   248 RSWIVDT 254
            |:|:..|
Zfish   253 RAWVDQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 93/233 (40%)
Tryp_SPc 31..254 CDD:238113 93/235 (40%)
LOC562139NP_001075159.1 Tryp_SPc 33..256 CDD:214473 93/233 (40%)
Tryp_SPc 34..259 CDD:238113 93/235 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4193
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.