DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and KLK15

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:267 Identity:83/267 - (31%)
Similarity:124/267 - (46%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVL 68
            |||::..|:|..|:..|:        :::.|::....:.|:||::. .:|...||.|||....||
Human     3 LLLTLSFLLASTAAQDGD--------KLLEGDECAPHSQPWQVALY-ERGRFNCGASLISPHWVL 58

  Fly    69 TAAHCMQSYAASELQVRVGS---TSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQT 130
            :||||...:    ::||:|.   ..|....::.|......|..|.::...||:.:::|..|.|..
Human    59 SAAHCQSRF----MRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLN 119

  Fly   131 SKIRAIELADSEAVSGTNAVVSGWGTTCF----------LFCSSPDTLQKVEVDLLHYKDCAADT 185
            .::|...|.......|...||||||....          ...|.||||....:.::  .|.:.|.
Human   120 PQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISII--SDTSCDK 182

  Fly   186 YNYGSDSILETMVCATGEKK--DACQGDSGGPLVADNKLVGVVSWGS-GCAWTGYPGVYADVASL 247
            ...|  .:..|||||..|.:  ::|:||||||||....|.|:||||. .|..|..||||..|...
Human   183 SYPG--RLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHY 245

  Fly   248 RSWIVDT 254
            ..||.:|
Human   246 LEWIRET 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 73/236 (31%)
Tryp_SPc 31..254 CDD:238113 75/238 (32%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.