DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and prss1

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001015792.1 Gene:prss1 / 548509 XenbaseID:XB-GENE-5776262 Length:244 Species:Xenopus tropicalis


Alignment Length:231 Identity:96/231 - (41%)
Similarity:135/231 - (58%) Gaps:17/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVG--STSRS 92
            :||.|........|||||:..  |.||||||||:|:.|::||||.:    |.:|||:|  :.:.:
 Frog    21 KIVGGFTCTKNAVPYQVSLNA--GYHFCGGSLINSQWVVSAAHCYK----SRIQVRLGEHNIAVN 79

  Fly    93 SGGE--VVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWG 155
            .|.|  :.:.:..| |..|||:.:.||:.:||||:..|.:|.|:::.|..:.|.:|||.::||||
 Frog    80 EGTEQFIESQKVIK-HPSYNSRNLDNDIMLIKLSTTARLSSNIQSVPLPSACASAGTNCLISGWG 143

  Fly   156 TTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCA--TGEKKDACQGDSGGPLVA 218
            .|.....:.||.||.:...:|...:|:    |.....|...|.||  ....||:||||||||:|.
 Frog   144 NTLSSGTNYPDLLQCLNAPILTASECS----NSYPGEITNNMFCAGFLAGGKDSCQGDSGGPVVC 204

  Fly   219 DNKLVGVVSWGSGCAWTGYPGVYADVASLRSWIVDT 254
            :.:|.||||||.|||...|||||..|.:..|||.:|
 Frog   205 NGQLQGVVSWGYGCAQRNYPGVYTKVCNYVSWIQNT 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 93/226 (41%)
Tryp_SPc 31..254 CDD:238113 95/228 (42%)
prss1NP_001015792.1 Tryp_SPc 22..240 CDD:238113 95/228 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.