DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Elane

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:268 Identity:74/268 - (27%)
Similarity:118/268 - (44%) Gaps:45/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSE 65
            :.||....:|.:.||... |.|.|   ...||.|.......:|:..|:| .:|.||||.:||...
Mouse     3 LGRLSSRTLAAMLLALFL-GGPAL---ASEIVGGRPARPHAWPFMASLQ-RRGGHFCGATLIARN 62

  Fly    66 TVLTAAHCMQSYAASELQVRVGS---TSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPV 127
            .|::||||:.......:||.:|:   ..:....:..:|:.. :..|::...::||:.||:|:...
Mouse    63 FVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRI-FENGFDPSQLLNDIVIIQLNGSA 126

  Fly   128 RQTSKIRAIEL-ADSEAVSG-TNAVVSGW---GTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYN 187
            ...:.::..:| |..:.|.. |..:..||   ||.    ..||..||::.|              
Mouse   127 TINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTN----RPSPSVLQELNV-------------- 173

  Fly   188 YGSDSILETM------VCATGEKKDA--CQGDSGGPLVADNKLVGVVSW-GSGCAWTGYPGVYAD 243
                :::..|      ||....::.|  |.||||||||.:|.:.|:.|: ..||....||..:|.
Mouse   174 ----TVVTNMCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAP 234

  Fly   244 VASLRSWI 251
            ||....||
Mouse   235 VAEFADWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 64/237 (27%)
Tryp_SPc 31..254 CDD:238113 66/238 (28%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 64/237 (27%)
Tryp_SPc 29..245 CDD:238113 66/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.