DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Prss53

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:303 Identity:82/303 - (27%)
Similarity:126/303 - (41%) Gaps:66/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLSVVALVALAASC-HGNPGLDFP-FGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETV 67
            ::.:..|.|...:| ...||...| .|..:.||      :|:|.||: .:|.|.|.|||:....|
  Rat    15 VIVIEGLQAAQRACGQRGPGPPEPQEGNTLPGE------WPWQASVR-RQGVHICSGSLVADTWV 72

  Fly    68 LTAAHCMQSYAASEL---QVRVGSTSR---SSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSP 126
            ||||||.:..|.:||   .|.:||..:   |.|.|.|.|.|.:..:.||.....:|:|:::|:.|
  Rat    73 LTAAHCFEKMATAELSSWSVVLGSLKQEGLSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHP 137

  Fly   127 VRQTSKIRAIELADSEAVSGTNAVVSGW------GTTC----------------FLFCS------ 163
            :..|:  ..:.........|.:...:||      |..|                ...||      
  Rat   138 IVHTT--LCLPQPTHHFPFGASCWATGWDQNTSDGKYCPRHKSRESQTGSVLTVLALCSHCVSEL 200

  Fly   164 ----SP----DTLQKVEVDLLHYKDCAADTYNYGSDSILET-----MVCATGEK--KDACQGDSG 213
                ||    .||:.:.:.|:....|.. .||.....:|..     |:|...:.  :..||||||
  Rat   201 DSTLSPLPVSRTLRNLRLRLISRPTCNC-LYNRLHQRLLANPARSGMLCGGAQPGVQGPCQGDSG 264

  Fly   214 GPLVADNK-----LVGVVSWGSGCAWTGYPGVYADVASLRSWI 251
            ||::....     .||::|:.|.||....|.:..|:|:..||:
  Rat   265 GPVMCREPDGHWVQVGIISFTSNCAQEDTPVLLTDMAAHSSWL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 74/274 (27%)
Tryp_SPc 31..254 CDD:238113 75/275 (27%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 75/273 (27%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.