DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and deltaTry

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:255 Identity:130/255 - (50%)
Similarity:170/255 - (66%) Gaps:11/255 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGN------PGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLI 62
            :|..|:.|.|:|.:..|.      |.||   ||||.|....|.::|:|:|:|.: |||.||||:.
  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLD---GRIVGGSATTISSFPWQISLQRS-GSHSCGGSIY 61

  Fly    63 DSETVLTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPV 127
            .|..::|||||:||.:||.||:|.||:..||||...:|.:||.|||||:..|:||:||||::..:
  Fly    62 SSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGAL 126

  Fly   128 RQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDS 192
            ..:|.|:||.||.|...:|..|.||||||..:...|.|..||.|.|:::....||:.||.||| .
  Fly   127 TFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGS-Q 190

  Fly   193 ILETMVCATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWIV 252
            |..||:||....|||||||||||||:...||||||||.|||::.|||||||||:||||::
  Fly   191 IRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 119/220 (54%)
Tryp_SPc 31..254 CDD:238113 119/222 (54%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 119/220 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443166
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.840

Return to query results.
Submit another query.