DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and ctrl

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:260 Identity:106/260 - (40%)
Similarity:141/260 - (54%) Gaps:22/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLSVVALVALAASCHGNPGLDFP----FGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSE 65
            ::|..||||....| |.|.:. |    :.||||||:....::|:|||:|.:.|.||||||||:..
Zfish     4 IISCFALVASTLGC-GVPAIK-PVISGYNRIVNGENAVSGSWPWQVSLQQSNGFHFCGGSLINQY 66

  Fly    66 TVLTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFK---YHEGYNSKLMINDVAIIKLSSPV 127
            .|:|||||  ...|....|.:|...|.|..|.|.|::..   .|..|||:...||:.::|||||.
Zfish    67 WVVTAAHC--RVQAGYHYVILGEHDRGSSAESVQVKSIAKAITHPYYNSQNFNNDITLLKLSSPA 129

  Fly   128 RQTSKIRAIELADSEA--VSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGS 190
            :.||:|..:.||.|..  .|||..|.:|||.|.  ..|||..||:..:.||....|   ...:|.
Zfish   130 QLTSRISPVCLAASSTSIPSGTRCVTTGWGKTG--STSSPRILQQTALPLLSPAQC---KQYWGQ 189

  Fly   191 DSILETMVCATGEKKDACQGDSGGPLVADNK----LVGVVSWGSGCAWTGYPGVYADVASLRSWI 251
            :.|.:.|:||......:||||||||||.::.    .||:||||:.......|.|||.|:.||.||
Zfish   190 NRITDAMICAGASGVSSCQGDSGGPLVCESSGAWYQVGIVSWGTSDCNVRTPAVYARVSYLRQWI 254

  Fly   252  251
            Zfish   255  254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 95/229 (41%)
Tryp_SPc 31..254 CDD:238113 96/230 (42%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 95/229 (41%)
Tryp_SPc 32..257 CDD:238113 96/230 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4193
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10565
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.990

Return to query results.
Submit another query.