DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and KLK12

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:259 Identity:92/259 - (35%)
Similarity:122/259 - (47%) Gaps:45/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHF-CGGSLIDSETV 67
            |||.|:.|...|..            :|.||.:....:.|:||.:  .:|:.. |||.|||...|
Human     7 LLLCVLGLSQAATP------------KIFNGTECGRNSQPWQVGL--FEGTSLRCGGVLIDHRWV 57

  Fly    68 LTAAHCMQSYAASELQVRVGSTS----------RSSGGEVVTVRAFKYHEGY--NSKLMINDVAI 120
            ||||||    :.|...||:|..|          |.||..|.       |.||  .|....:|:.:
Human    58 LTAAHC----SGSRYWVRLGEHSLSQLDWTEQIRHSGFSVT-------HPGYLGASTSHEHDLRL 111

  Fly   121 IKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADT 185
            ::|..|||.||.::.:.|.:..|.:||...|||||.|.......||.||.:.:.::.:..|    
Human   112 LRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATC---- 172

  Fly   186 YNYGSDSILETMVCATG-EKKDACQGDSGGPLVADNKLVGVVSWGS--GCAWTGYPGVYADVAS 246
            :......|...||||.| ..:||||||||||||....|.|:|||||  .|...|.||||..:.:
Human   173 HGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYICN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 86/233 (37%)
Tryp_SPc 31..254 CDD:238113 86/232 (37%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 86/231 (37%)
Tryp_SPc 22..236 CDD:238113 86/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.