DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG34130

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:286 Identity:64/286 - (22%)
Similarity:121/286 - (42%) Gaps:70/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALV------ALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSH------- 55
            |||:.|...      :.|:..||.|.:     |.:|           :..::.|.|.|       
  Fly    12 LLLTEVGAAHSSWWNSSASYLHGRPPV-----RTLN-----------KNGIRRTSGGHAVPWLLR 60

  Fly    56 -------FCGGSLIDSETVLTAAHCMQSYAA--SELQVR-VGSTSRSSGGEVVTVRAFKYHEGYN 110
                   .||.|.:.:...||:|:||.|:.:  ..|.|. |.|.||..       .....|:..|
  Fly    61 IVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSRQD-------NQLDSHDPPN 118

  Fly   111 S---KLMIN----------DVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFC 162
            :   .::::          |||:|:|::.:| .::...:.|..:...|..:..|..:|      .
  Fly   119 ALIRNIIVSKDWHWPGTFMDVAVIELTNRLR-GNRNNYVTLCTNPLSSYKSLSVVSYG------A 176

  Fly   163 SSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKKDA-CQGDSGGPLVADNKLVGVV 226
            ...:.::..|:::|:...|.:   .||:..:.||:.||...|:.| |...:|.|:.|.::|.|:|
  Fly   177 GPAENVRTEEIEVLNRMICDS---AYGNFLLRETVACAKEFKRSADCMFSAGCPVTAGDQLCGIV 238

  Fly   227 SWGSGCAWTGYPGVYADVASLRSWIV 252
            :|...|..:..||::.|:..::.:|:
  Fly   239 AWSPACKRSNLPGIFTDIHQVKRFIL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 55/251 (22%)
Tryp_SPc 31..254 CDD:238113 55/253 (22%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 51/226 (23%)
Tryp_SPc 53..256 CDD:304450 50/219 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.