DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG7829

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:231 Identity:92/231 - (39%)
Similarity:130/231 - (56%) Gaps:15/231 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSR 91
            |..|||.|...||.|.||.||:| ..|.|.||||:|::.|:|||.||:.......|:|:||.|||
  Fly    24 PDPRIVGGFPADIANIPYIVSIQ-LYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTSR 87

  Fly    92 -SSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWG 155
             ...||:.:|...:.||.:|.|.|..|:.||:|:..:..:.|::||.:.......||.|.::|||
  Fly    88 YRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWG 152

  Fly   156 TTCFLFCSSP--DTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKK---DACQGDSGGP 215
               |...:.|  |:|:...|.:::...|.    |....::.:.|:|| |..|   ||||.|||||
  Fly   153 ---FKSMNGPPSDSLRYARVPIVNQTACR----NLLGKTVTDRMLCA-GYLKGGTDACQMDSGGP 209

  Fly   216 LVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWI 251
            |....:|||:||||.|||....||||:.:.:|..|:
  Fly   210 LSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 90/226 (40%)
Tryp_SPc 31..254 CDD:238113 90/227 (40%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 90/225 (40%)
Tryp_SPc 28..248 CDD:238113 90/227 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443378
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.