DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and intr

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:264 Identity:61/264 - (23%)
Similarity:99/264 - (37%) Gaps:67/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKG----------SHF-----------CGGSLIDS 64
            :|.:...|....|.|...:|..|.::....|.|          .||           |.|:||.:
  Fly    56 SPKISARFSSGGNKEPNSLEIIPAEIETLLTDGQATTEAPKAVKHFVMRILYENKVICSGALIST 120

  Fly    65 ETVLTAAHCM---------QSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAI 120
            ..|||:|.|.         :||.....:.|:.|.:....|                  .|.|:|:
  Fly   121 RLVLTSALCFPRTLRQPPPRSYKLQASRSRIYSVANLITG------------------AIEDMAL 167

  Fly   121 IKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADT 185
            :.|.:|: :...:..|:|.:|......|       .|.::   |...|:.:...|:...:|..  
  Fly   168 LLLHAPL-EDPFVHPIDLCESPLRRNDN-------VTMYM---SQQHLRFLRTKLIPNSNCKR-- 219

  Fly   186 YNYGSDS---ILETMVCATGEKKDA-CQGDSGGPLVADNKLVGVVSWGSGCAWTGYPG-VYADVA 245
             :|..|.   |.:||:||....:.. ||...|..|:..::|.||..:|..|:..|..| :||||.
  Fly   220 -SYAQDENAFITQTMLCALNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADVF 283

  Fly   246 SLRS 249
            ..|:
  Fly   284 KART 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 59/255 (23%)
Tryp_SPc 31..254 CDD:238113 59/254 (23%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 50/203 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.