DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG5255

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:269 Identity:88/269 - (32%)
Similarity:133/269 - (49%) Gaps:27/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQ-TTKGSHFCGGSLIDSETV 67
            :||.:|...:.|||....|. .:...|||.||:......|||:|:| ...|:|.|||::||...:
  Fly     4 ILLPLVLFTSSAASQILYPP-QYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWI 67

  Fly    68 LTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKY--------HEGYNSKLMINDVAIIKLS 124
            :|||||.:...|:..:|..|:......|.       ||        |..|..:...||:|::.|:
  Fly    68 ITAAHCTRGRQATAFRVLTGTQDLHQNGS-------KYYYPDRIVEHSNYAPRKYRNDIALLHLN 125

  Fly   125 SPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYG 189
            ..:...:..:.:||.....|.|:..:::||||.. |....|..||.:||:.:.::.|.|...|  
  Fly   126 ESIVFDNATQPVELDHEALVPGSRLLLTGWGTLS-LGGDVPARLQSLEVNYVPFEQCRAAHDN-- 187

  Fly   190 SDSILETMVCATGEK-KDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWI-- 251
            |..:....||...:| :.||.||||||||.:.|||.:|:||..|| .|||..:|.::....:|  
  Fly   188 STRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCA-KGYPDAHASISYYHDFIRT 251

  Fly   252 ---VDTTDS 257
               :..|||
  Fly   252 HLSLSKTDS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 77/230 (33%)
Tryp_SPc 31..254 CDD:238113 77/237 (32%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 77/230 (33%)
Tryp_SPc 30..252 CDD:238113 77/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.