DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG5246

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:262 Identity:86/262 - (32%)
Similarity:135/262 - (51%) Gaps:19/262 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALV----ALAASCHGNPGLDFPFG------RIVNGEDVDIENYPYQVSVQTTKGSHFCG 58
            :|:||:.::    |.:...|....|:...|      |::.|.|......|||||:..|.|.|.||
  Fly     5 VLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCG 69

  Fly    59 GSLIDSETVLTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKL 123
            ||:|..:.:|||||||: :....|::..|:...:..|....|...|.|..::.....||:|:|..
  Fly    70 GSIIAPQWILTAAHCME-WPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIHT 133

  Fly   124 SSPVRQTSKIRAIELADSEAVS--GTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTY 186
            :.|:......:.|:||...::.  |....::|||:| ..:......|||::::.:.:.:|.:...
  Fly   134 AKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGST-KTWGRYSTQLQKIDLNYIDHDNCQSRVR 197

  Fly   187 NYGSDSILETMVCA-TGEKKDACQGDSGGPLV-ADNKLVGVVSWGSGCAWTGYPGVYADVASLRS 249
            |  ::.:.|..||. |.|.:.:|.|||||||| |:..|||||:||..|| .|||.|:..||....
  Fly   198 N--ANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACA-IGYPDVFGSVAYYHD 259

  Fly   250 WI 251
            ||
  Fly   260 WI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 77/224 (34%)
Tryp_SPc 31..254 CDD:238113 78/225 (35%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 77/224 (34%)
Tryp_SPc 42..263 CDD:238113 78/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.