DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG17475

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:272 Identity:90/272 - (33%)
Similarity:132/272 - (48%) Gaps:26/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLLLSVVALVALAASCHGNP---------------------GLDFPFGRIVNGEDVDIENYPY 44
            |.||.:..:.::.||.:|: .|                     |::|. .|::|||||.:....|
  Fly     1 MVRLGVVQILVILLACTCY-KPISAVRLAQLSEDQLEWISKAEGVNFQ-NRVINGEDVQLGEAKY 63

  Fly    45 QVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGY 109
            |:|:|...|.|.|||.:||...|||||||:..|..:.|:|..|:........|..|.....|..|
  Fly    64 QISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNY 128

  Fly   110 NSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVD 174
            ||....||:|:|:|:..::.....:..||..:...:||..:::|||:| .|:..:||.|||..:.
  Fly   129 NSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGST-ELWGDTPDILQKAYLT 192

  Fly   175 LLHYKDCAADTYNYGSDSILETMVCATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPG 239
            .:.|..|.....|..|:.........|| .:.||.|||||||..:..|.|:|:||..|| .|.|.
  Fly   193 HVVYSTCQEIMNNDPSNGPCHICTLTTG-GQGACHGDSGGPLTHNGVLYGLVNWGYPCA-LGVPD 255

  Fly   240 VYADVASLRSWI 251
            .:|:|.....||
  Fly   256 SHANVYYYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 79/220 (36%)
Tryp_SPc 31..254 CDD:238113 80/221 (36%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 79/220 (36%)
Tryp_SPc 50..269 CDD:238113 80/221 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.