DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG17477

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:226 Identity:75/226 - (33%)
Similarity:116/226 - (51%) Gaps:4/226 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSRSSGG 95
            ||.|::....:.|||||:||..|||.|||::|....::||.||::.|..|.|||..|:...:..|
  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG 91

  Fly    96 EVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVV-SGWGTTCF 159
            .|....|...|..|:|....||:.::.|:..:...:..:|:||..|....|.:.:| :|||:.. 
  Fly    92 AVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQS- 155

  Fly   160 LFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKK-DACQGDSGGPLVADNKLV 223
            ...|.|..||:|:...|:...|.:....|....:....:||..:.. .||.||||||||....||
  Fly   156 AAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGTLV 220

  Fly   224 GVVSWGSGCAWTGYPGVYADVASLRSWIVDT 254
            |::::...|| .|.|.::.::...|.|:..|
  Fly   221 GILNFFVPCA-QGVPDIFMNIMYYRDWMRQT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 73/221 (33%)
Tryp_SPc 31..254 CDD:238113 74/224 (33%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 74/224 (33%)
Tryp_SPc 27..246 CDD:214473 73/220 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.