DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG12951

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:259 Identity:80/259 - (30%)
Similarity:133/259 - (51%) Gaps:19/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVL 68
            |.||::.::|:.......|.:    .|:|||.|..:..||:.||:::..|||.||||:|....|:
  Fly     7 LSLSLIVILAVTTVGQAAPSI----SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVM 67

  Fly    69 TAAHCMQSYAASELQVRVGSTSRSS-GGEVVTVRAFKYHEGYN-SKLMINDVAIIKLSSPVR--- 128
            |||||.....|..|.::.|.|:.|: |..||.::....||.:: ::...||::::.:..|..   
  Fly    68 TAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDG 132

  Fly   129 ---QTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGS 190
               ...::.|:..|..::.:|...|:.|||.. ..:.|..||||:|.:.:...::|   |..:..
  Fly   133 VSVAPVELPALAFAVPQSDAGVEGVLIGWGLN-DTYGSVQDTLQEVSLKIYSDEEC---TSRHNG 193

  Fly   191 DSILETMVCATGEK--KDACQGDSGGPLVADNKLVGVVSWG-SGCAWTGYPGVYADVASLRSWI 251
            .:..:..:|...::  |..|.|||||||:.:.:.||:|||. ..|....|||||..|:....||
  Fly   194 QTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 73/231 (32%)
Tryp_SPc 31..254 CDD:238113 74/232 (32%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 73/231 (32%)
Tryp_SPc 30..260 CDD:238113 74/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.