DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Klk4

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:257 Identity:78/257 - (30%)
Similarity:117/257 - (45%) Gaps:26/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVL 68
            |:|.|....|.:.|           .||:.|:|....:.|:|.::.:...:.||.|.|:..:.||
  Rat    16 LILEVTGSSASSIS-----------SRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVL 69

  Fly    69 TAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKI 133
            :||||:|......|.:.....|:..|..::.......|..||.....||:.:|||:..|.:::.|
  Rat    70 SAAHCIQDSYTVGLGLHNLEGSQEPGSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVMESNTI 134

  Fly   134 RAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAA---DTYNYGSDSILE 195
            |.|.:|......|...:|||||.  ......|..||.|.:.:...:.|..   ..|:.       
  Rat   135 RRIPVASQCPTPGDTCLVSGWGR--LKNGKLPSLLQCVNLSVASEETCRLLYDPVYHL------- 190

  Fly   196 TMVCATG--EKKDACQGDSGGPLVADNKLVGVVSWGSG-CAWTGYPGVYADVASLRSWIVDT 254
            :|.||.|  ::||.|.||||||:|.:..|.|:||.|.| |...|.|.||.::....:||..|
  Rat   191 SMFCAGGGPDRKDTCNGDSGGPIVCNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWIWTT 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 70/226 (31%)
Tryp_SPc 31..254 CDD:238113 71/228 (31%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 68/222 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.