DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Sems

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:285 Identity:94/285 - (32%)
Similarity:126/285 - (44%) Gaps:54/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENY-------PYQVSV----QTTK-- 52
            |.|||.    |..||.....|..|.       :.|.:|::..       .||..|    .||.  
  Fly     1 MKRLLF----LFLLAGILINNHALQ-------HNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAK 54

  Fly    53 -----------GSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSR-SSGGEVVTVRAFKY 105
                       .:..|||:||....|||||||.:..|..|.....|..|| |..|....|:.|..
  Fly    55 LGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIK 119

  Fly   106 HEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPD---- 166
            ...:....|..|||::.|:.|: ....|..:.|..:....|....|||||.|      :||    
  Fly   120 SAQFKMVTMNMDVAVVLLNRPM-VGKNIGTLSLCSTALTPGQTMDVSGWGMT------NPDDEGP 177

  Fly   167 --TLQKVEVDLLHYKDCAADTYNYGSDSILETMVCAT--GEKKDACQGDSGGPLVADNKLVGVVS 227
              .|:.|.|.::..:.| .:.|. .|.||.::|.||:  | |||||..|||||||.:.::.|:||
  Fly   178 GHMLRTVSVPVIEKRIC-REAYR-ESVSISDSMFCASVLG-KKDACTYDSGGPLVYEKQVCGIVS 239

  Fly   228 WGSGCAWTGYPGVYADVASLRSWIV 252
            :|.|||...|||||.||..::.:||
  Fly   240 FGIGCASRRYPGVYTDVHYVKPFIV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 83/253 (33%)
Tryp_SPc 31..254 CDD:238113 85/255 (33%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 79/229 (34%)
Tryp_SPc 44..265 CDD:238113 81/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.