DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG32271

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:255 Identity:96/255 - (37%)
Similarity:139/255 - (54%) Gaps:25/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVL 68
            |:|.::.| ..|||...|       .|||.|..|||.:.||.|::: ..|:..|||||:..:.|:
  Fly     6 LVLHLIPL-CWAASNEAN-------SRIVGGVPVDIASVPYLVNLR-IGGNFMCGGSLVTPQHVV 61

  Fly    69 TAAHCMQSYAASELQVRVGSTS------RSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPV 127
            |||||::...||.:.|..|.|.      ||...:|.|.:|      ||::.:.:|||::||.:|:
  Fly    62 TAAHCVKGIGASRILVVAGVTRLTETGVRSGVDKVYTPKA------YNTRTLTSDVAVLKLKAPI 120

  Fly   128 RQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDS 192
             ...|:..|||.::...:|....|||||.......:....::.|:|.|:..|.|.:.....|  :
  Fly   121 -SGPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRG--T 182

  Fly   193 ILETMVCAT-GEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWI 251
            |..||.||: ...||||:||||||.|...:|.|:||||.|||....||||.:|.::||:|
  Fly   183 ITNTMFCASVPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 88/227 (39%)
Tryp_SPc 31..254 CDD:238113 88/228 (39%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 88/227 (39%)
Tryp_SPc 25..244 CDD:238113 88/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.