DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG9897

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:275 Identity:86/275 - (31%)
Similarity:128/275 - (46%) Gaps:40/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVL 68
            :||.:|||          |.|.....||:||..|:|::.|:..|: .......|||::|....:|
  Fly     6 ILLQIVAL----------PWLALGDQRIINGNTVNIKDAPWYASI-IVNSKLKCGGAIISKNYIL 59

  Fly    69 TAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKI 133
            |||.|:..|:|..:|||:|::|..:.|.:..:...|.|..|:|....|::|::|....:..|.:|
  Fly    60 TAAKCVDGYSARSIQVRLGTSSCGTSGSIAGICKVKVHSQYSSWRFDNNLALLKTCELLNTTDEI 124

  Fly   134 RAIELADSEAVSGTNAVVSGWG--------------------TTCFLFCSSPDTLQKVEVDLLHY 178
            :.||.||......:.|.|:|.|                    ..||   ..|..|...:|.:|..
  Fly   125 KPIERADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCF---QLPVQLHGTQVRILSQ 186

  Fly   179 KDCAAD---TYNYGSDSILETMVCATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGV 240
            |.||||   ...|....|.:..:|.....|.||..|.|.|||.||||||::| .:||:..  |.|
  Fly   187 KQCAADWKVIPFYLLKGISDLTICTKSPGKGACSTDRGSPLVIDNKLVGILS-RAGCSIK--PDV 248

  Fly   241 YADVASLRSWIVDTT 255
            ||::....:|:...|
  Fly   249 YANILGHTNWLDSNT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 77/243 (32%)
Tryp_SPc 31..254 CDD:238113 77/245 (31%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.