DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG11192

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:269 Identity:105/269 - (39%)
Similarity:150/269 - (55%) Gaps:22/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETV 67
            :.|..::||||.|.:. ..||    .||||.||...|:.:||||||| .:|.|.|||::|..:||
  Fly     5 KFLWWLMALVAYAGAT-PTPG----DGRIVGGEVATIQEFPYQVSVQ-LQGRHICGGAIIGIDTV 63

  Fly    68 LTAAHCMQS-YAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTS 131
            ||||||.:. :::::..|||||:...|||.|:::|....|..||.:...||:|::.|:..:..|.
  Fly    64 LTAAHCFEDPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTE 128

  Fly   132 KIRAIELA--DSEAVSGTNAVVSGWGTTCFLFCSSPDT-----LQKVEVDLLHYKDCAADTYNYG 189
            .::.:.||  .....:.|...|||||........|.:.     |:.|:|||:....|.. .|:..
  Fly   129 HLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRR-AYSQV 192

  Fly   190 SDSILETMVCATGEKKDACQGDSGGPLV------ADNKLVGVVSWGSGCAWTGYPGVYADVASLR 248
            . .|...|:||....:|:||||||||||      ...:|.|:||||.|||...:||||.:||:.|
  Fly   193 L-PITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFR 256

  Fly   249 SWIVDTTDS 257
            |||.:..|:
  Fly   257 SWIDEQLDA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 93/234 (40%)
Tryp_SPc 31..254 CDD:238113 94/236 (40%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 93/234 (40%)
Tryp_SPc 28..262 CDD:238113 94/236 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443278
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.