DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Ser8

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:263 Identity:117/263 - (44%)
Similarity:159/263 - (60%) Gaps:20/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLLLSVVALVALAASCHGNPGLDFP-----FGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGS 60
            |:.|:.:.:||:||........||: |     .||||.|....||:.|:|||:|.: ||||||||
  Fly     1 MSLLIATFLALLALTNGAVIPIGLE-PQTSSLGGRIVGGTASSIEDRPWQVSLQRS-GSHFCGGS 63

  Fly    61 LIDSETVLTAAHCMQS-YAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLS 124
            :|.:..::|||||:.: ...|.|::|.||..|:.||.:|.|.|.|.||.|||...|||:.:::|.
  Fly    64 IISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLK 128

  Fly   125 SPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPD-----TLQKVEVDLLHYKDCAAD 184
            :.:...|.|:||.:|.:....|:.|.:||||.|      |.|     ||..|:..::....|.:.
  Fly   129 TKLTFGSTIKAITMASATPAHGSAASISGWGKT------STDGPSSATLLFVDTRIVGRSQCGSS 187

  Fly   185 TYNYGSDSILETMVCATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRS 249
            ||.||| .|..||:||....|||||||||||||:..:||||||||..||...||||||::|.||.
  Fly   188 TYGYGS-FIKATMICAAATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRD 251

  Fly   250 WIV 252
            |::
  Fly   252 WVL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 106/226 (47%)
Tryp_SPc 31..254 CDD:238113 106/228 (46%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 106/226 (47%)
Tryp_SPc 35..253 CDD:238113 105/225 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443165
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 1 0.900 - - OOG6_107380
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
109.750

Return to query results.
Submit another query.