DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and thetaTry

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:264 Identity:137/264 - (51%)
Similarity:183/264 - (69%) Gaps:8/264 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLLLSVVALVALAASCHGNPGLD--FPF---GRIVNGEDVDIENYPYQVSVQTTKGSHFCGGS 60
            |:||::.:|.| |:.::|.|..|:.  .||   ||||.|||..|..:|||||:||..||||||||
  Fly     1 MHRLVVLLVCL-AVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGS 64

  Fly    61 LIDSETVLTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSS 125
            ||:.:||:|||||:.....|::.||:|||..:.||.||.||...|:|.||||.|..||.|:||..
  Fly    65 LINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDE 129

  Fly   126 PVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSS-PDTLQKVEVDLLHYKDCAADTYNYG 189
            .|::|..||.||||.....:||.|||:|||:.|:.:|.: |.|||:|.|:::.:|.||:|.|.||
  Fly   130 KVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYG 194

  Fly   190 SDSILETMVCATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWIVDT 254
             :.|.::||||..:|||||||||||||...|.|||:||||..||....||||:||.:||.||::.
  Fly   195 -EIIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWILNA 258

  Fly   255 TDSL 258
            :::|
  Fly   259 SETL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 122/221 (55%)
Tryp_SPc 31..254 CDD:238113 123/223 (55%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 122/221 (55%)
Tryp_SPc 35..255 CDD:238113 121/220 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452482
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4193
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
98.900

Return to query results.
Submit another query.