DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and etaTry

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:265 Identity:105/265 - (39%)
Similarity:145/265 - (54%) Gaps:25/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLLLSVVALVAL----AASCHGNPGLDFPFGRIVNGEDVD--IENYPYQVSVQTTKGSHF--- 56
            ||:::|.::|::.|    |.|...:       ||||.|.|..  ...|..|:..:::..|.:   
  Fly     1 MNKVILRILAVLFLLGIYAVSAQSD-------GRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQT 58

  Fly    57 CGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSRSS-GGEVVTVRAFKYHEGYNSKLMINDVAI 120
            |||.::|:.|:.|||||:.:..|....|..|..||.. .|.||.|.....||.|||..|.||:|:
  Fly    59 CGGCILDAVTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIAL 123

  Fly   121 IKLSS--PVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAA 183
            :.:..  |:...|.:.|||:|..:...|..|.:||||.|.....|| |.||:|:|.::..:.| .
  Fly   124 VVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSS-DQLQQVKVPIVDSEKC-Q 186

  Fly   184 DTYNYGSDSILETMVCA--TGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVAS 246
            :.|.:  ..|.|.|:||  :...|||||||||||||..|||.|:||||.|||...||||||:||.
  Fly   187 EAYYW--RPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAY 249

  Fly   247 LRSWI 251
            .:.||
  Fly   250 YKDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 95/230 (41%)
Tryp_SPc 31..254 CDD:238113 96/231 (42%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 95/230 (41%)
Tryp_SPc 28..257 CDD:238113 96/231 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.