DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and zetaTry

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster


Alignment Length:275 Identity:111/275 - (40%)
Similarity:156/275 - (56%) Gaps:37/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGNPGLD------FPFGRIVNGEDVDIENYPYQVSVQ----TTKGS---H 55
            ||..:|:||||.   .|.|.|:      .|.||||.|...||...|||:|::    ||..:   |
  Fly     9 LLAFLVSLVALT---QGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRH 70

  Fly    56 FCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSRS-SGGEVVTVRAFKYHEGYNSKLMI-NDV 118
            .||||:.:..|::|||||:....||:.:|..|:..:: |.|.:..|:....||||.|.... ||:
  Fly    71 RCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDI 135

  Fly   119 AIIKLSSPVRQTS-KIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSP-----DTLQKVEVDLLH 177
            ||:.:..|:...: .|:||:||..:.:.||.:.|||||||      ||     :.|..|:|.::.
  Fly   136 AILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTT------SPGGYSSNQLLAVDVPIVS 194

  Fly   178 YKDCAADTYNYGSDS--ILETMVCATGEK----KDACQGDSGGPLVADNKLVGVVSWGSGCAWTG 236
            .:.|..|..::|.::  |...|:|| |::    .|||||||||||...::|.||||||:.||...
  Fly   195 NELCDQDYEDFGDETYRITSAMLCA-GKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPN 258

  Fly   237 YPGVYADVASLRSWI 251
            ||||||:||.||.||
  Fly   259 YPGVYANVAYLRPWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 97/241 (40%)
Tryp_SPc 31..254 CDD:238113 98/242 (40%)
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 97/241 (40%)
Tryp_SPc 39..276 CDD:238113 98/242 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443245
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.