DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG8170

DIOPT Version :10

Sequence 1:NP_610109.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster


Alignment Length:61 Identity:15/61 - (24%)
Similarity:23/61 - (37%) Gaps:14/61 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FVIDPANKL--------------SANYMATYQTSSKMLGLEWSNNSKSTGSFKVCASMNLA 149
            |..||.|.:              .||.:....|:..|.....||:|..|.|..|.::.::|
  Fly   991 FQEDPGNSVPTATHITPAVTVANGANQVKAESTNDSMNDSIASNDSMGTNSSGVSSTSSVA 1051

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_610109.1 Tryp_SPc 30..251 CDD:214473 15/61 (25%)
CG8170NP_610441.2 Tryp_SPc 612..846 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.