DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and KLK3

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:246 Identity:81/246 - (32%)
Similarity:118/246 - (47%) Gaps:34/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTS---R 91
            |||.|.:.:..:.|:||.| .::|...|||.|:..:.|||||||:::.:.    :.:|..|   .
Human    24 RIVGGWECEKHSQPWQVLV-ASRGRAVCGGVLVHPQWVLTAAHCIRNKSV----ILLGRHSLFHP 83

  Fly    92 SSGGEVVTVRAFKYHEGYNSKLMIN-----------DVAIIKLSSPVRQTSKIRAIELADSEAVS 145
            ...|:|..|.....|..|:..|:.|           |:.:::||.|...|..::.::|...|...
Human    84 EDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPAL 148

  Fly   146 GTNAVVSGWGT---TCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCA---TGEK 204
            ||....||||:   ..||   :|..||.|::.::....||    ......:.:.|:||   || .
Human   149 GTTCYASGWGSIEPEEFL---TPKKLQCVDLHVISNDVCA----QVHPQKVTKFMLCAGRWTG-G 205

  Fly   205 KDACQGDSGGPLVADNKLVGVVSWGS-GCAWTGYPGVYADVASLRSWIVDT 254
            |..|.||||||||.:..|.|:.|||| .||....|.:|..|...|.||.||
Human   206 KSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 77/241 (32%)
Tryp_SPc 31..254 CDD:238113 78/243 (32%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 78/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.