DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and PRSS53

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:305 Identity:83/305 - (27%)
Similarity:122/305 - (40%) Gaps:74/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVALAASC-HGNPGLDFP-FGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHC 73
            |.|...:| ...||...| .|..|.||      :|:|.||: .:|:|.|.|||:....|||||||
Human    21 LQAAQRACGQRGPGPPKPQEGNTVPGE------WPWQASVR-RQGAHICSGSLVADTWVLTAAHC 78

  Fly    74 MQSYAASEL---QVRVGSTSR---SSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSK 132
            .:..||:||   .|.:||..|   |.|.|.|.|.|.:....||.....:|:|:::|:.|...|. 
Human    79 FEKAAATELNSWSVVLGSLQREGLSPGAEEVGVAALQLPRAYNHYSQGSDLALLQLAHPTTHTP- 142

  Fly   133 IRAIELADSEAVSGTNAVVSGW---------------------------GTTCFLFCS------- 163
             ..:.........|.:...:||                           ...|..|.|       
Human   143 -LCLPQPAHRFPFGASCWATGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQ 206

  Fly   164 ----------SPDTLQKVEVDLLHYKDCAADTYN-----YGSDSILETMVCATGEK--KDACQGD 211
                      :|.||:.:.:.|:....|.. .||     :.|:.....|:|...:.  :..||||
Human   207 TLAPAPSLSPAPGTLRNLRLRLISRPTCNC-IYNQLHQRHLSNPARPGMLCGGPQPGVQGPCQGD 270

  Fly   212 SGGPLVA---DNKLV--GVVSWGSGCAWTGYPGVYADVASLRSWI 251
            ||||::.   |...|  |::|:.|.||....|.:..:.|:..||:
Human   271 SGGPVLCLEPDGHWVQAGIISFASSCAQEDAPVLLTNTAAHSSWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 75/282 (27%)
Tryp_SPc 31..254 CDD:238113 76/283 (27%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 76/284 (27%)
Tryp_SPc 43..314 CDD:214473 74/280 (26%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.