DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG1304

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:270 Identity:94/270 - (34%)
Similarity:132/270 - (48%) Gaps:49/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVALAASCHGNPG-LDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCM 74
            |:.||...|..|| |:   ||:|.|||.....:|:|||::.. |||.||||::....|||||||:
  Fly    14 LLLLAVPVHSAPGSLN---GRVVGGEDAVKNQFPHQVSLRNA-GSHSCGGSILSRNYVLTAAHCV 74

  Fly    75 QS---------YAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQT 130
            .:         .||....:|.||..|.|||.:|.|.....||.|.:  .:||||:::|.||:..:
  Fly    75 TNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGN--FLNDVALLRLESPLILS 137

  Fly   131 SKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILE 195
            :.|:.|:|..::..:..:.::||||..            |.:.||..|..     ||......||
  Fly   138 ASIQPIDLPTADTPADVDVIISGWGRI------------KHQGDLPRYLQ-----YNTLKSISLE 185

  Fly   196 -----------TMVCATGEKKD-ACQGDSGGPLVADNKLVGVVS--WGSGCAWTGYPGVYADVAS 246
                       :.:|...|..: ||.||||||.|.:|::|||..  | |.|. |.||..||.|..
  Fly   186 RCDELIGWGVQSELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVW-SACG-TSYPDGYARVYY 248

  Fly   247 LRSWIVDTTD 256
            ...||.:.:|
  Fly   249 HNEWIKNNSD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 83/243 (34%)
Tryp_SPc 31..254 CDD:238113 84/245 (34%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 83/243 (34%)
Tryp_SPc 32..256 CDD:238113 84/245 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.