DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Prss34

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:278 Identity:95/278 - (34%)
Similarity:139/278 - (50%) Gaps:31/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGNP---GLDFPFGR----IVNGEDVDIENYPYQVS-----VQTTKGSHF 56
            :.|.::.|:.|:..|.||.   .||...|:    ||.|..|....:|:|||     ::.::..|.
Mouse     1 MCLGMLWLLFLSLPCLGNTMPLTLDLGSGQGLVGIVGGCPVSASRFPWQVSLRLYDMEHSRWEHE 65

  Fly    57 CGGSLIDSETVLTAAHCM--QSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMIN--- 116
            ||||||..:.|||||||:  :...|..::|:||........:::.|.....|..::.||...   
Mouse    66 CGGSLIHPQWVLTAAHCVRPKEVEAYGVRVQVGQLRLYENDQLMKVVKIIRHPKFSEKLSARGGA 130

  Fly   117 DVAIIKLSSPVRQTSKIRAIEL-ADSEAVSGTNAV-VSGWGT-TCFLFCSSPDTLQKVEVDLLHY 178
            |:|::||.:.|..:..:..:.| |.|..:|..... |:|||. ..::....|..|::|.|.::..
Mouse   131 DIALLKLDTRVVLSEHVYPVSLPAASLRISSKKTCWVAGWGVIENYMPLPPPYHLREVAVPIVEN 195

  Fly   179 KDCAADTY--NYGSDS----ILETMVCATGEKKDACQGDSGGPLVADNKL----VGVVSWGSGCA 233
            .|| ...|  |..|||    |.:.|:||..|.:|:|:.|||||||.....    |||||||.||.
Mouse   196 NDC-EQKYQTNSSSDSTTRIIKDDMLCAGKEGRDSCKADSGGPLVCRWNCSWVQVGVVSWGIGCG 259

  Fly   234 WTGYPGVYADVASLRSWI 251
            ...:||||..|.|..|||
Mouse   260 LPDFPGVYTRVMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 84/247 (34%)
Tryp_SPc 31..254 CDD:238113 86/244 (35%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 86/244 (35%)
Tryp_SPc 35..277 CDD:214473 84/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.