DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG33159

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:222 Identity:77/222 - (34%)
Similarity:109/222 - (49%) Gaps:6/222 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSRSSG 94
            |||.|::..|...||.|.:: ..|...||||||.|..||:||||:.........|..|::.....
  Fly    25 RIVGGKETTISEVPYLVYLR-QNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRLDQE 88

  Fly    95 GEVV-TVRAFKYHEGYNSKLMINDVAIIKLSSPVRQT-SKIRAIELADSEAVSGTNAVVSGWGTT 157
            ..|| .|..|.....|::.....|||:::|...|..| .|:..|....:.......|.:||||.|
  Fly    89 APVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPPEGNAYARISGWGVT 153

  Fly   158 CFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGE-KKDACQGDSGGPLVADNK 221
            ........:.::...|.:|...:|......||  .:.::|:||... .:|:|.||||||||...:
  Fly   154 RENNREPAEQVRTTMVRVLPGAECKISYSGYG--QLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQ 216

  Fly   222 LVGVVSWGSGCAWTGYPGVYADVASLR 248
            :.|:||||.|||...:||||.:|||.|
  Fly   217 VCGIVSWGFGCARPSFPGVYTNVASER 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 77/222 (35%)
Tryp_SPc 31..254 CDD:238113 76/221 (34%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 74/218 (34%)
Tryp_SPc 26..251 CDD:238113 76/221 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.