DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG32523

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:233 Identity:74/233 - (31%)
Similarity:114/233 - (48%) Gaps:19/233 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQS----YAASELQVRVGSTS 90
            |||.|.......:|:|:|:: .:|.|:|||.:|.:..|:||.||::.    ..|....::.||..
  Fly    36 RIVGGIKAKQGQFPHQISLR-LRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLL 99

  Fly    91 RSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWG 155
            .||.|..:.|.....|..|.:. ..||:|:::|.||:...:.|.||:||..:..:.....:||||
  Fly   100 LSSDGVRIPVAEVIMHPNYATG-GHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWG 163

  Fly   156 TTCFLFCSSP--DTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKKD-ACQGDSGGPLV 217
            .   :....|  |:|..|:|..:....|....|:    .:.|||:|....|.. ||.||||||..
  Fly   164 N---IAEKGPLSDSLLFVQVTSISRGACRWMFYS----RLPETMICLLHSKNSGACYGDSGGPAT 221

  Fly   218 ADNKLVGVVS--WGSGCAWTGYPGVYADVASLRSWIVD 253
            ...|:||:.|  .|.||. ...|..|..::.:|:||.:
  Fly   222 YGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWIAE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 72/229 (31%)
Tryp_SPc 31..254 CDD:238113 73/232 (31%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/229 (31%)
Tryp_SPc 37..219 CDD:238113 59/190 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.