DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG32376

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:231 Identity:82/231 - (35%)
Similarity:117/231 - (50%) Gaps:13/231 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCM----QSYAASELQVRV 86
            || .|||||:.:.....|:|.|:. .:|...||..:|:...:|||.||.    :.|.     |||
  Fly    62 FP-TRIVNGKRIPCTEAPFQGSLH-YEGYFVCGCVIINKIWILTAHHCFFGPPEKYT-----VRV 119

  Fly    87 GSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVS-GTNAV 150
            ||..:..||::..|:.......||...|.:|:|::||.|||.....:|.::|..::... ....|
  Fly   120 GSDQQRRGGQLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFV 184

  Fly   151 VSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKKDACQGDSGGP 215
            |||||.|.....:....|::|::|.:....| ...|......|.:.|:||:...||:|.||||||
  Fly   185 VSGWGITSANAQNVQRYLRRVQIDYIKRSKC-QKMYKKAGLKIYKDMICASRTNKDSCSGDSGGP 248

  Fly   216 LVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWI 251
            |.:...|.|:||||.|||...|||||.:......||
  Fly   249 LTSRGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 78/225 (35%)
Tryp_SPc 31..254 CDD:238113 79/226 (35%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 78/225 (35%)
Tryp_SPc 66..287 CDD:238113 79/226 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
43.910

Return to query results.
Submit another query.