DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Klk15

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:268 Identity:88/268 - (32%)
Similarity:128/268 - (47%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVL 68
            |||:.|.||:.|..  |:        :::.||:....:.|:||:: ..:|...||..||....||
Mouse     3 LLLAFVLLVSAAQD--GD--------KVLEGEECVPHSQPWQVAL-FERGRFNCGAFLISPRWVL 56

  Fly    69 TAAHCMQSYAASELQVRVGSTS-RSSGG--EVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQT 130
            |||||...:    ::||:|..: |...|  ::.:|.....|.||.::...:|:.:::|..|.|.|
Mouse    57 TAAHCQTRF----MRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPARLT 117

  Fly   131 SKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSS--------------PDTLQKVEVDLLHYKDC 181
            :.:|.:.|.....:.|.:.||||||    |...:              ||||....:.::....|
Mouse   118 AYVRPVALPRRCPLIGEDCVVSGWG----LLSDNNPGATGSQKSHVRLPDTLHCANISIISEASC 178

  Fly   182 AADTYNYGSDSILETMVCA--TGEKKDACQGDSGGPLVADNKLVGVVSWGS-GCAWTGYPGVYAD 243
            ..|.    ...:|.|||||  .|...|:|:||||||||....|.|:||||. .|..|..||||..
Mouse   179 NKDY----PGRVLPTMVCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTK 239

  Fly   244 VASLRSWI 251
            |.|...||
Mouse   240 VCSYLEWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 78/240 (33%)
Tryp_SPc 31..254 CDD:238113 80/241 (33%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 78/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.