DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Prtn3

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:236 Identity:70/236 - (29%)
Similarity:110/236 - (46%) Gaps:33/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVNGEDVDIENYPYQVSVQTTK--GSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGS---- 88
            :||.|.:....:.||..|:|.::  |||||||:||....|||||||:|..:...:.|.:|:    
  Rat   197 KIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVLGAHDLL 261

  Fly    89 TSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIEL--ADSEAVSGTNAVV 151
            :|.....:....:.|:  ..||.:..:|||.:::|:.|.....::....|  .|.....||..:.
  Rat   262 SSEPEQQKFTITQVFE--NNYNPEETLNDVLLLQLNRPASLGKQVAVASLPQQDQSLSQGTQCLA 324

  Fly   152 SGW---GTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKKDA--CQGD 211
            .||   ||.    ..:|..|.::.|.::.:. |.            |..||....::.|  |.||
  Rat   325 MGWGRLGTR----APTPRVLHELNVTVVTFL-CR------------EHNVCTLVPRRAAGICFGD 372

  Fly   212 SGGPLVADNKLVGVVSWG-SGCAWTGYPGVYADVASLRSWI 251
            |||||:.:..|.||.|:. ..||...:|..:|.|:...:||
  Rat   373 SGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVNWI 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 68/234 (29%)
Tryp_SPc 31..254 CDD:238113 70/235 (30%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 70/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.