DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Prss30

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:241 Identity:90/241 - (37%)
Similarity:126/241 - (52%) Gaps:21/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCM-QSYAASELQVRVGSTSRS 92
            |:||.|:|.....:|:|||:..|:..|.||||||....|||||||. :|...|...|:||..:.|
Mouse    72 GKIVGGQDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVGGLTLS 136

  Fly    93 ---SGGEVVTVRAFKYHEGYN-SKLMINDVAIIKLSSPVR--QTSKIRAIELADSEAVSGTNAVV 151
               ....:|.||....|..|. :.....|:|:::|.:|:|  |.:.: .:..|.:....||...|
Mouse   137 LLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQFTPV-CLPAAQTPLTPGTVCWV 200

  Fly   152 SGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGS----DSILET-MVCA--TGEKKDACQ 209
            :|||.|.....:|  .||::.|.||..:||....:..||    :.|::: |:||  ...:||:||
Mouse   201 TGWGATQERDMAS--VLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAGYVEGQKDSCQ 263

  Fly   210 GDSGGPLVADNK----LVGVVSWGSGCAWTGYPGVYADVASLRSWI 251
            ||||||||....    .||:.|||.|||....||||..|.:...||
Mouse   264 GDSGGPLVCSINSSWTQVGITSWGIGCARPYRPGVYTRVPTYVDWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 87/238 (37%)
Tryp_SPc 31..254 CDD:238113 89/239 (37%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 89/239 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.