DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:253 Identity:87/253 - (34%)
Similarity:131/253 - (51%) Gaps:17/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQ 75
            |:.||....|.|.:.....|||.|.......:|:|.|::..| .|.|||||:..|.|||||||..
  Rat    10 LLLLAVPGCGQPQVSHAGSRIVGGHAAQAGAWPWQASLRLQK-VHVCGGSLLSPEWVLTAAHCFS 73

  Fly    76 -SYAASELQVRVGSTSRSSGGEVVTVR-AFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIEL 138
             |..:|:.:|.:|..:.:......||: ...|...........|:|:::|::||..:|:::.:.|
  Rat    74 GSVNSSDYEVHLGELTITLSPHFSTVKQIIMYSSAPGPPGSSGDIALVQLATPVALSSQVQPVCL 138

  Fly   139 ADSEA--VSGTNAVVSGWGTTCF---LFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILET-M 197
            .::.|  ..|....|:|||.|..   |  ..|..||:.:|.::..:.| :..|:..:.|:::: |
  Rat   139 PEASADFHPGMQCWVTGWGYTQEGEPL--KPPYNLQEAKVSVVDVETC-SQAYSSSNGSLIQSDM 200

  Fly   198 VCATGEKKDACQGDSGGPLVADN----KLVGVVSWGSGCAWTGYPGVYADVASLRSWI 251
            :||.| ..||||.|||||||...    :..||||||.||.....|||||.|.:..:||
  Rat   201 LCAWG-PGDACQDDSGGPLVCRVAGIWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 80/232 (34%)
Tryp_SPc 31..254 CDD:238113 81/233 (35%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 80/232 (34%)
Tryp_SPc 30..260 CDD:238113 81/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.