DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Klk9

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:266 Identity:88/266 - (33%)
Similarity:127/266 - (47%) Gaps:30/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSV-QTTKGSHFCGGSLIDSET 66
            :|.|::|....||..|    |.|   .|.|...:....:.|:|..: ..|:  ..||.:||:.:.
  Rat     2 KLGLTLVLFSLLAGHC----GAD---TRAVGARECQRNSQPWQAGLFYLTR--QLCGATLINDQW 57

  Fly    67 VLTAAHCMQSYAASELQVRVGSTS--RSSGGE-VVTVRAFKYHEGYNSKLMIN----DVAIIKLS 124
            :||||||.:.|    |.||:|...  :..|.| ::.|..|..|.|:|..|..|    |:.:|:|.
  Rat    58 LLTAAHCRKPY----LWVRLGEHHLWQWEGPEKLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLP 118

  Fly   125 SPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYG 189
            ..||.:..::.:.|:.|....||..::||||:........|.|||...:.:|..|.|   .:.| 
  Rat   119 RKVRLSPAVQPLNLSQSLPSVGTQCLISGWGSVSSSKIQFPMTLQCANISILDNKLC---RWAY- 179

  Fly   190 SDSILETMVCA---TGEKKDACQGDSGGPLVADNKLVGVVSWGS-GCAWTGYPGVYADVASLRSW 250
            ...|.|.|:||   .| .:.:||||||||||....|.|:||.|| .|:....|.||..|.....|
  Rat   180 PGHISEKMLCAGLWEG-GRGSCQGDSGGPLVCKGTLAGIVSGGSEPCSRPQRPAVYTSVFHYLDW 243

  Fly   251 IVDTTD 256
            |.:|.:
  Rat   244 IENTVE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 77/232 (33%)
Tryp_SPc 31..254 CDD:238113 78/234 (33%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 78/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.