DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Klk11

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:261 Identity:87/261 - (33%)
Similarity:132/261 - (50%) Gaps:32/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSV-QTTKGSHFCGGSLIDSETV 67
            ::|..:||..:.....|..       ||:.|.:....:.|:||:: |.|:  ..||.:||..:.:
  Rat    31 MILRFIALALVTGHVGGET-------RIIKGYECRPHSQPWQVALFQKTR--LLCGATLIAPKWL 86

  Fly    68 LTAAHCMQSY-----AASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKL----MINDVAIIKL 123
            ||||||.:.:     ....|:...|...|....|     :|. |.|:|:.|    ..||:.::|:
  Rat    87 LTAAHCRKPHYVILLGEHNLEKTDGCEQRRMATE-----SFP-HPGFNNSLPNKDHRNDIMLVKM 145

  Fly   124 SSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNY 188
            |||...|..:|.:.|:.....:||:.::||||||.......|.:|:...|.::.:|:|.. .|  
  Rat   146 SSPAFITRAVRPLTLSSLCVTAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIGHKECER-AY-- 207

  Fly   189 GSDSILETMVCATGEK--KDACQGDSGGPLVADNKLVGVVSWGSG-CAWTGYPGVYADVASLRSW 250
             ..:|.:||:||:..|  ||:||||||||||.:..|.|::|||.. ||.|..||||..|.....|
  Rat   208 -PGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFDW 271

  Fly   251 I 251
            |
  Rat   272 I 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 81/233 (35%)
Tryp_SPc 31..254 CDD:238113 82/234 (35%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 81/233 (35%)
Tryp_SPc 51..275 CDD:238113 82/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.