DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Klk13

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:274 Identity:92/274 - (33%)
Similarity:138/274 - (50%) Gaps:39/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDI-----------ENYPYQVSVQTTKGSHFCG 58
            |::.:|.:.||.|  |....|:|  :|:||.:...           .:.|:|.:: ..:|...||
  Rat     4 LVATIACLTLALS--GGISRDYP--KILNGTNGTSGFLPGGYTCLPHSQPWQAAL-LVRGRLLCG 63

  Fly    59 GSLIDSETVLTAAHCMQ-SYAASELQVRVG--STSRSSGGE--VVTVRAFKYHEGYNSKLMIN-- 116
            |.|:..:.|||||||.: .|.     |.:|  :..|...||  :..||:..:.|...|...:|  
  Rat    64 GVLVHPKWVLTAAHCRKDGYT-----VHLGKHALGRVENGEQAMEVVRSIPHPEYQVSPTHLNHD 123

  Fly   117 -DVAIIKLSSPVRQTSKIRAIEL-ADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYK 179
             |:.:::|.|||:.::.:|.::| ||....:||...|||||||.....:.|.|||...::|...:
  Rat   124 HDIMLLELKSPVQLSNHVRTLQLSADDCLPTGTCCRVSGWGTTTSPQVNYPKTLQCANIELRSDE 188

  Fly   180 DCAADTYNYGSDSILETMVCATGEK---KDACQGDSGGPLVADNKLVGVVSWGS-GCAWTGYPGV 240
            :| ...|   ...|...|:|| |.|   ||:|:|||||||:.:.||.|::|||. .|.....|||
  Rat   189 EC-RQVY---PGKITANMLCA-GTKEGGKDSCEGDSGGPLICNGKLYGIISWGDFPCGQPNRPGV 248

  Fly   241 YADVASLRSWIVDT 254
            |..|:....||..|
  Rat   249 YTRVSKYLRWIQGT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 81/244 (33%)
Tryp_SPc 31..254 CDD:238113 83/246 (34%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 80/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.