DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:272 Identity:94/272 - (34%)
Similarity:134/272 - (49%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLSVVALVALAASCHGNPGLDFPFGR---IVNGEDVDIENYPYQVSVQTTKGS---HFCGGSLID 63
            ||.::||..||:..|..|   .|..:   ||.|.:.....:|:|||:: .|.|   ||||||||.
  Rat     4 LLLLLALSPLASLVHAAP---CPVKQRVGIVGGREASESKWPWQVSLR-FKFSFWMHFCGGSLIH 64

  Fly    64 SETVLTAAHCMQSYAAS-EL-QVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSP 126
            .:.|||||||:..:..| || :|::.........:::||.....|..|.:.....|:|:::|.:|
  Rat    65 PQWVLTAAHCVGLHIKSPELFRVQLREQYLYYADQLLTVNRTVVHPHYYTVEDGADIALLELENP 129

  Fly   127 VRQTSKIRAIEL--ADSEAVSGTNAVVSGWGTTCFLFCSS------PDTLQKVEVDLLHYKDCAA 183
            |..::.|....|  |.....|||:..|:|||.     ..|      |..|::|:|.::....|..
  Rat   130 VNVSTHIHPTSLPPASETFPSGTSCWVTGWGD-----IDSDEPLLPPYPLKQVKVPIVENSLCDR 189

  Fly   184 DTYN--YGSDS---ILETMVCATGEKKDACQGDSGGPLVADNK----LVGVVSWGSGCAWTGYPG 239
            ..:.  |..|.   :.:.|:||...:.|:||||||||||...|    ..||||||.|||....||
  Rat   190 KYHTGLYTGDDVPIVQDGMLCAGNTRSDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAEANRPG 254

  Fly   240 VYADVASLRSWI 251
            :|..|.....||
  Rat   255 IYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 83/245 (34%)
Tryp_SPc 31..254 CDD:238113 85/243 (35%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 85/243 (35%)
Tryp_SPc 30..266 CDD:214473 83/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.