DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Prss38

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:262 Identity:82/262 - (31%)
Similarity:129/262 - (49%) Gaps:44/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHC----- 73
            |:::| |.|.|   .|:::.||......:|:|||:... |.|.||||::::..|||||||     
  Rat   101 LSSAC-GQPAL---HGKLLGGELTIDRKWPWQVSIHYA-GFHVCGGSILNAYWVLTAAHCFAREK 160

  Fly    74 -MQSY----AASELQVRVGSTSRSSGGEVVTVRAFK-YHEGYNSKLMINDVAIIKLSSPVRQTSK 132
             :|::    ..:.|:|....|......:|:....|: :|.      :..|||:::..|.:..:..
  Rat   161 RLQTFDMYVGITNLEVANKHTQWFEINQVIIHPTFEMFHP------VGGDVALVQSKSAIVFSDY 219

  Fly   133 IRAIELADSEA-VSGTNAVVSGWGTTCFLFCSSPD-----TLQKVEVDLLHYKDCAADTYNYGSD 191
            :..|.|..|.. :|..:...:|||..      ||.     .|.:.::.|:....|   ...||..
  Rat   220 VLPICLPSSNLNLSDLSCWTTGWGMV------SPQGETGKDLLEAQLPLIPKFQC---QLLYGLT 275

  Fly   192 S-ILETMVCATGEK--KDACQGDSGGPLVAD-NKL---VGVVSWGSGCAWTGYPGVYADVASLRS 249
            | :|..|:||...|  |:.|:||||.|||.. |:.   :|:||||.|||...||||:|:|:...:
  Rat   276 SYLLPEMLCAGDIKNMKNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLN 340

  Fly   250 WI 251
            ||
  Rat   341 WI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 74/244 (30%)
Tryp_SPc 31..254 CDD:238113 76/245 (31%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 76/243 (31%)
Tryp_SPc 116..342 CDD:214473 74/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.