DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Prss34

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:251 Identity:87/251 - (34%)
Similarity:121/251 - (48%) Gaps:38/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVNGEDVDIENYPYQVS-----VQTTKGSHFCGGSLIDSETVLTAAHC--MQSYAASELQVRVGS 88
            ||.|..|....:|:|||     ::.:|..|.||||||..:.|||||||  ::...||..:|:||.
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQ 97

  Fly    89 TSRSSGGEVVTVRAFKYHEGYNSKLMI---NDVAIIKLSSPVRQTSKIRAIEL-ADSEAVSGTNA 149
            .......:::.|.....|..::.||..   .|:|::||.|.|..:.::..:.| |.|:.:|....
  Rat    98 LRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQRISSKKT 162

  Fly   150 -VVSGWGT---------TCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGS-----DSILETMVC 199
             .|:|||.         .|.        |::|.|.::...||......|.|     ..|.:.|:|
  Rat   163 WWVAGWGVIEGHRPLPPPCH--------LREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLC 219

  Fly   200 ATGEKKDACQGDSGGPLVADNKL----VGVVSWGSGCAWTGYPGVYADVASLRSWI 251
            |..|.:|:||.|||||||.....    |||||||.||....:||||..|.|..|||
  Rat   220 AGMEGRDSCQADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 85/249 (34%)
Tryp_SPc 31..254 CDD:238113 87/251 (35%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 87/251 (35%)
Tryp_SPc 33..275 CDD:214473 85/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.