DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Prss30

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:245 Identity:95/245 - (38%)
Similarity:126/245 - (51%) Gaps:23/245 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCM-QSYAASELQVRVGSTSRS 92
            |:||.|:|.....:|:|||::|.|..|.||||||....|||||||. :...:|...|:||..:.|
  Rat    29 GKIVGGQDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGLTLS 93

  Fly    93 ---SGGEVVTVR-AFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEA--VSGTNAVV 151
               ....:|.|| .|.|...........|:|:::|.:|: |.|:...:.|..::|  ..||...|
  Rat    94 LTEPHSTLVAVRNIFVYPTYLWEDASSGDIALLRLDTPL-QPSQFSPVCLPQAQAPLTPGTVCWV 157

  Fly   152 SGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDS------ILETMVCA--TGEKKDAC 208
            :|||.|.....:|  .||::.|.||..:||.. .|:.|..|      |...|:||  ...:||:|
  Rat   158 TGWGATHERELAS--VLQELAVPLLDSEDCER-MYHIGETSLSGKRVIQSDMLCAGFVEGQKDSC 219

  Fly   209 QGDSGGPLV-ADNK---LVGVVSWGSGCAWTGYPGVYADVASLRSWIVDT 254
            ||||||||| |.|.   .||:.|||.|||....||||..|.....||..|
  Rat   220 QGDSGGPLVCAINSSWIQVGITSWGIGCARPNKPGVYTRVPDYVDWIQRT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 91/239 (38%)
Tryp_SPc 31..254 CDD:238113 93/241 (39%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.