DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and KLK9

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:260 Identity:83/260 - (31%)
Similarity:122/260 - (46%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSV-QTTKGSHFCGGSLIDSETVLTAAHC 73
            ||::|.|. ||     :...|.:..|:....:.|:|..: ..|:  .|||.:||....:||||||
Human     8 ALLSLLAG-HG-----WADTRAIGAEECRPNSQPWQAGLFHLTR--LFCGATLISDRWLLTAAHC 64

  Fly    74 MQSYAASELQVRVGSTS--RSSGGE-VVTVRAFKYHEGYNSKLMIN----DVAIIKLSSPVRQTS 131
            .:.|    |.||:|...  :..|.| :..|..|..|.|:|..|..|    |:.:|:|....|.:.
Human    65 RKPY----LWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSP 125

  Fly   132 KIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILET 196
            .::.:.|:.:....|...::||||.........|.|||...:.:|..|.|......:.|||    
Human   126 AVQPLNLSQTCVSPGMQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAYPGHISDS---- 186

  Fly   197 MVCA---TGEKKDACQGDSGGPLVADNKLVGVVSWGS-GCAWTGYPGVYADVASLRSWIVDTTDS 257
            |:||   .| .:.:||||||||||.:..|.||||.|: .|:....|.||..|.....||.:..::
Human   187 MLCAGLWEG-GRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLDWIQEIMEN 250

  Fly   258  257
            Human   251  250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 75/232 (32%)
Tryp_SPc 31..254 CDD:238113 76/234 (32%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.