DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:257 Identity:93/257 - (36%)
Similarity:133/257 - (51%) Gaps:18/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAA 71
            |:...|:..:.| |:|.:.....|||.|.......:|:|.|::..| .|.|||||:..|.|||||
Mouse    64 SLANSVSSGSGC-GHPQVSNSGSRIVGGHAAPAGTWPWQASLRLHK-VHVCGGSLLSPEWVLTAA 126

  Fly    72 HCMQ-SYAASELQVRVGSTSRSSGGEVVTV-RAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIR 134
            ||.. |..:|:.||.:|..:.:......|| |...|...........|:|:::|||||..:|:::
Mouse   127 HCFSGSVNSSDYQVHLGELTVTLSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQ 191

  Fly   135 AIELADSEA--VSGTNAVVSGWGTTCF---LFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSIL 194
            .:.|.::.|  ..|....|:|||.|..   |  ..|..||:.:|.::..|.| :..||..:.|::
Mouse   192 PVCLPEASADFYPGMQCWVTGWGYTGEGEPL--KPPYNLQEAKVSVVDVKTC-SQAYNSPNGSLI 253

  Fly   195 E-TMVCATGEKKDACQGDSGGPLVADN----KLVGVVSWGSGCAWTGYPGVYADVASLRSWI 251
            : .|:||.| ..||||.|||||||...    :..||||||.||.....|||||.|.:..:||
Mouse   254 QPDMLCARG-PGDACQDDSGGPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 86/232 (37%)
Tryp_SPc 31..254 CDD:238113 87/233 (37%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 87/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.