DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and KLK13

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:272 Identity:90/272 - (33%)
Similarity:134/272 - (49%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLSVVALVALAASCHGNPGLDFPFGRIVN----------GEDVDIENYPYQVSVQTTKGSHFCGG 59
            |..|:|.:.||.|    .|:.....:::|          |......:.|:|.:: ..:|...|||
Human     4 LALVIASLTLALS----GGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAAL-LVQGRLLCGG 63

  Fly    60 SLIDSETVLTAAHCMQSYAASELQVRVG--STSRSSGGEVV--TVRAFKYHEGYNSKLMIN---D 117
            .|:..:.|||||||::    ..|:|.:|  :..|...||.|  .|.:..:.|...|...:|   |
Human    64 VLVHPKWVLTAAHCLK----EGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHD 124

  Fly   118 VAIIKLSSPVRQTSKIRAIELADSEAVS-GTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDC 181
            :.:::|.|||:.|..|:.:.|:.:..:: ||...|||||||.....:.|.|||...:.|...::|
Human   125 IMLLELQSPVQLTGYIQTLPLSHNNRLTPGTTCRVSGWGTTTSPQVNYPKTLQCANIQLRSDEEC 189

  Fly   182 AADTYNYGSDSILETMVCATGEK---KDACQGDSGGPLVADNKLVGVVSWGS-GCAWTGYPGVYA 242
             ...|   ...|.:.|:|| |.|   ||:|:||||||||.:..|.|:||||. .|.....||||.
Human   190 -RQVY---PGKITDNMLCA-GTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYT 249

  Fly   243 DVASLRSWIVDT 254
            .|:....||.:|
Human   250 RVSRYVLWIRET 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 80/242 (33%)
Tryp_SPc 31..254 CDD:238113 82/244 (34%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 81/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.