DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and TPSG1

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:243 Identity:85/243 - (34%)
Similarity:119/243 - (48%) Gaps:15/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQ-SYAASELQ 83
            |.|.:....||||.|.......:|:|.|::..: .|.|||||:..:.|||||||.. |..:|:.|
Human    52 GRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRR-VHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQ 115

  Fly    84 VRVGSTSRSSGGEVVTVRAFKYHEGYNSKL-MINDVAIIKLSSPVRQTSKIRAIEL--ADSEAVS 145
            |.:|....:......|||....|...:.:. ...|:|:::||.||..:|:|..:.|  |..:...
Human   116 VHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASDDFCP 180

  Fly   146 GTNAVVSGWGTTCF---LFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKKDA 207
            |....|:|||.|..   |  ..|.:|::|:|.::..:.|..|....|...:...|:||.| ..||
Human   181 GIRCWVTGWGYTREGEPL--PPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARG-PGDA 242

  Fly   208 CQGDSGGPLVADNK----LVGVVSWGSGCAWTGYPGVYADVASLRSWI 251
            ||.|||||||....    ..|.||||.||.....||||..|.:..:||
Human   243 CQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 80/231 (35%)
Tryp_SPc 31..254 CDD:238113 81/232 (35%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 80/231 (35%)
Tryp_SPc 63..293 CDD:238113 81/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.