DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and KLK5

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:233 Identity:86/233 - (36%)
Similarity:125/233 - (53%) Gaps:18/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSRS-- 92
            ||:||.|.|:...|:|.::.......:||..|:..:.:||||||.:..    .:||:|..|.|  
Human    66 RIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKV----FRVRLGHYSLSPV 126

  Fly    93 --SGGEVVT-VRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGW 154
              ||.::.. |::.. |.||:.....||:.:|||:..:|.|..:|.|.::.....:||..:||||
Human   127 YESGQQMFQGVKSIP-HPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGW 190

  Fly   155 GTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEK--KDACQGDSGGPLV 217
            |||.......|..||.:.:.:|..|.| .|.|....|   :||.|| |:|  :|:||||||||:|
Human   191 GTTKSPQVHFPKVLQCLNISVLSQKRC-EDAYPRQID---DTMFCA-GDKAGRDSCQGDSGGPVV 250

  Fly   218 ADNKLVGVVSWGS-GCAWTGYPGVYADVASLRSWIVDT 254
            .:..|.|:||||. .||....||||.::.....||.:|
Human   251 CNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQET 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 83/228 (36%)
Tryp_SPc 31..254 CDD:238113 84/230 (37%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 1/1 (100%)
Tryp_SPc 66..285 CDD:214473 83/228 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.