DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Prss1

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:262 Identity:102/262 - (38%)
Similarity:145/262 - (55%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLLLSVVALVALAASCHGNPGLDFPF---GRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLI 62
            |:.||  ::|||..|.:        ||.   .:||.|......:.|||||:.:  |.||||||||
  Rat     1 MSALL--ILALVGAAVA--------FPLEDDDKIVGGYTCPEHSVPYQVSLNS--GYHFCGGSLI 53

  Fly    63 DSETVLTAAHCMQSYAASELQVRVGSTS-RSSGGEVVTVRAFKY--HEGYNSKLMINDVAIIKLS 124
            :.:.|::||||.:    |.:|||:|..: ....|:...:.|.|.  |..|:|..:.||:.:||||
  Rat    54 NDQWVVSAAHCYK----SRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLS 114

  Fly   125 SPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYG 189
            |||:..:::..:.|..:.|.:||..::||||.|.....::||.||.|:..:|...||.| .|   
  Rat   115 SPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEA-AY--- 175

  Fly   190 SDSILETMVCA--TGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWIV 252
            ...|..:|:|.  ....||:||||||||:|.:.:|.|:||||.|||....||||..|.:...||.
  Rat   176 PGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQ 240

  Fly   253 DT 254
            ||
  Rat   241 DT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 89/225 (40%)
Tryp_SPc 31..254 CDD:238113 91/227 (40%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 89/225 (40%)
Tryp_SPc 24..242 CDD:238113 91/227 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.